PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015879436.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 511aa    MW: 55592.7 Da    PI: 6.1964
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015879436.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-39146206262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC+s++tkfCyynny++ qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  XP_015879436.1 146 PDKILPCPRCNSMDTKFCYYNNYNVDQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSA 206
                     7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30143203IPR003851Zinc finger, Dof-type
PfamPF027011.7E-32148204IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.798150204IPR003851Zinc finger, Dof-type
PROSITE patternPS013610152188IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MSEPKDPAIK LFGMTIPVPE VSVSSGYSPG APRSSSSSSA PVLEDGKDQE RASSSNSLIE  60
ANTNRDGDER EVDMDSLREK QTETTLEDGA QPLSSEDFMN PDPIPGIGGN PKTPSVETGT  120
ATLKSSKSEE EQSETSNSQE KTLKKPDKIL PCPRCNSMDT KFCYYNNYNV DQPRHFCKNC  180
QRYWTAGGTM RNVPVGAGRR KNKNSASHYR HLTVSEALQN ARTDVPNGIH GHHPSLKSNG  240
TVLTFGSDTP LCESMASVLS LADKTMRNST RNGLHKPEKL RVPVTYGGGE NGDDPLGGSS  300
VITTDTKHEE CKTGSQEQVM QNCQGFQPQM PCYPGAPWPY PWNSAQWSPP VPLPPFCPPG  360
FPMPFYPAAA YWGCSVPGTW NIPWLPQPPS PNQTALCSGP NSPTLGKHSR DENTLKANCS  420
GEEEPPKENN AERCLWIPKT LRIDDPGEAA KSSIWATLGI KNDKADSFSG RGLFKAFQSK  480
SDDKNHVAET SPVLQANPAA LSRSFNFQES S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879436.10.0PREDICTED: cyclic dof factor 2-like
TrEMBLW9QEV10.0W9QEV1_9R
STRINGVIT_14s0108g00980.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-106cycling DOF factor 2